PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00126816001
Common NameGSBRNA2T00126816001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 255aa    MW: 29007.7 Da    PI: 7.6417
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00126816001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof103.21.5e-322177561
               zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                          + cprC+stntkfCyynn+s+sqPry Ck+Crr Wt+GGalrn+P+Gg+  k+k++
  GSBRNA2T00126816001 21 PRVCPRCNSTNTKFCYYNNHSVSQPRYKCKECRRNWTHGGALRNIPIGGSGHKKKST 77
                         678***********************************************9999976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-201675IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.7422276IPR003851Zinc finger, Dof-type
PfamPF027015.8E-302276IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102460IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MDYSSVFAER GNEVNQEKPP PRVCPRCNST NTKFCYYNNH SVSQPRYKCK ECRRNWTHGG  60
ALRNIPIGGS GHKKKSTTID QPFVSQAVSA EIQQVSRHRQ PFLHAQETNQ FVESFGGSSS  120
GFDVDNHIGS FPEISGDGVL PFQSFPPMDR SYFHDGLFQQ DYYNAESNDL IGNHLINQSI  180
GSYNVVSSNH NSYINQEDRD KWNQSLNNTM NMNHNASTSG SREWWDTDHK NKYKGKIKNN  240
CVYESSYHLE KHGP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.51040.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00126816001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013654840.10.0PREDICTED: dof zinc finger protein DOF4.4-like
SwissprotQ9SUA93e-60DOF44_ARATH; Dof zinc finger protein DOF4.4
TrEMBLA0A078CI220.0A0A078CI22_BRANA; BnaA08g09880D protein
STRINGBra020881.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21050.15e-57Dof-type zinc finger domain-containing protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]